SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R013 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R013
Domain Number 1 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 191-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 416-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 107-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 13-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 70-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000183
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 517-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000326
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 238-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000293
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 11 Region: 154-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000466
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 378-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000686
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2R013
Sequence length 569
Comment (tr|H2R013|H2R013_PANTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSPTRP00000039950} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN= OC=Catarrhini; Hominidae; Pan.
Sequence
MAMVALFYPQSNPHGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGKFQ
HQRLLPREECYVCCECGKSFSKYVSFSNHQRVHTVKRPYECGECGKSFSKYDSLSNHQRV
HTDKKHYECGECGKSFSKYVSFSNHQRVHTGKRPYECGECGKSFSKYVSFSNHQRVHTDK
KHYECGECGKSFSKYVSFSNHQRVHTGEKPYGCEECGKSFSQKSSLIQHQQFHTGGKPYG
CEECGKYFSLEGHLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTGERPYKCGEC
EKSFSRKPSLSYHQRIHTEVRPYKCGECGKSYISKGHLRIHQRMHTGERPYKCGDCGKSF
NEKGHLRSHQRVHTTERPYKCGECGKCFSHKGNLILHQHGHTRKRPYMCWECGKLFKKKS
HLLVHQRIHSGEKPYACEACQKFFRHKCHLTAHQRVHTGERPYECSDCGKSFTHSCAFIV
HKRVHTGQKPYECSECGKSFAASSYLTSHRRVHTGQNECGKSFAGISSLTNHRRVHTGEK
PYGCSECEKKFRKSSSLRYRQRVHERKAL
Download sequence
Identical sequences H2R013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]