SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R0W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R0W3
Domain Number 1 Region: 24-226
Classification Level Classification E-value
Superfamily L domain-like 5.99e-40
Family Leucine rich effector protein YopM 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R0W3
Sequence length 277
Comment (tr|H2R0W3|H2R0W3_PANTR) Leucine rich repeat containing 10 {ECO:0000313|Ensembl:ENSPTRP00000041364} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0041464 OC=Catarrhini; Hominidae; Pan.
Sequence
MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLS
DNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLL
QNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLT
DFPAVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRW
AEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS
Download sequence
Identical sequences G3SF95 H2R0W3
9598.ENSPTRP00000041364 ENSGGOP00000026779 ENSPTRP00000041364 ENSPTRP00000041364 XP_004053599.1.27298 XP_522465.1.37143 ENSGGOP00000026779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]