SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R106 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2R106
Domain Number - Region: 237-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00184
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R106
Sequence length 379
Comment (tr|H2R106|H2R106_PANTR) Sad1 and UNC84 domain containing 5 {ECO:0000313|Ensembl:ENSPTRP00000041560} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0043000 OC=Catarrhini; Hominidae; Pan.
Sequence
MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQAL
GLTQCVLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI
HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQK
MAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSATYNHEKAHSYWNWIQLWNYAQPPDV
ILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYG
MEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFGAVKVKISSNWGNPGFTCLYRVRVH
GSVAPPREQPHQNPYPERD
Download sequence
Identical sequences H2R106
9598.ENSPTRP00000041560 ENSPTRP00000041560 XP_525300.2.37143 ENSPTRP00000041560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]