SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R1Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R1Q2
Domain Number 1 Region: 232-363
Classification Level Classification E-value
Superfamily PX domain 3.14e-27
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  H2R1Q2
Domain Number - Region: 389-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000202
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R1Q2
Sequence length 595
Comment (tr|H2R1Q2|H2R1Q2_PANTR) Sorting nexin {ECO:0000256|PIRNR:PIRNR027744} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0038148 OC=Catarrhini; Hominidae; Pan.
Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEIL
PSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWE
SSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKD
SESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYG
PMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVK
FGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEK
EWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAE
QPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKR
VSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Download sequence
Identical sequences H2R1Q2 Q9Y5X1
gi|7706706|ref|NP_057308.1| ENSPTRP00000042696 ENSP00000376024 ENSP00000252631 hso003010418.1 ENSPTRP00000042696 NP_057308.1.87134 NP_057308.1.92137 XP_001144722.1.37143 9598.ENSPTRP00000042696 9606.ENSP00000376024 ENSP00000376024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]