SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R2S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R2S9
Domain Number 1 Region: 340-496,541-584
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-46
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  H2R2S9
Domain Number - Region: 111-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R2S9
Sequence length 628
Comment (tr|H2R2S9|H2R2S9_PANTR) Ash2 (Absent, small, or homeotic)-like {ECO:0000313|EMBL:JAA06360.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0013122 OC=Catarrhini; Hominidae; Pan.
Sequence
MAAAGAGPGQEAGAGPGPGAAANATGAEEGEMKPVAAGAAAPPGEGTSAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences H2R2S9
9598.ENSPTRP00000044421 ENSPTRP00000044421 XP_003830776.1.60992 XP_016814375.1.37143 ENSPTRP00000044421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]