SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R3I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R3I9
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-20
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000236
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 12 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000274
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R3I9
Sequence length 696
Comment (tr|H2R3I9|H2R3I9_PANTR) Zinc finger protein 607 {ECO:0000313|Ensembl:ENSPTRP00000045597} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0030332 OC=Catarrhini; Hominidae; Pan.
Sequence
MAYGSITFGDVAIDFSHQEWEYLSLVQKTLYQEVMMENYDNLVSLAGHSVSKPDLITLLE
QGKEPWMIVREETRGECTDLDSRCEIISDGEMQLYRKHSSVTLHQRIHNGQKPYECKQCQ
KSFSHLTELMVHQTIHTSEEPDQCEKFRKAFSHLTDLRKHQKINAREKPYECEECGKVFS
YPANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRL
SRHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHK
RIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFES
VEKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKP
YKCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQ
ECGKGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNECGK
SFRFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSH
ASHLIIHERIHTSDKPYECKRCGKAFHCASYLVRHESVHADGNPYMCEECGKAFNSSHEL
SIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences H2R3I9
XP_001166123.2.37143 XP_009433775.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]