SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R5E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R5E9
Domain Number 1 Region: 121-359,402-480,525-618
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.87e-124
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000266
Further Details:      
 
Domain Number 2 Region: 602-725
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.16e-31
Family Anticodon-binding domain of Class II aaRS 0.00025
Further Details:      
 
Domain Number 3 Region: 70-105
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000471
Family a tRNA synthase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2R5E9
Sequence length 739
Comment (tr|H2R5E9|H2R5E9_PANTR) GARS isoform 2 {ECO:0000313|EMBL:PNI35811.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0037805 OC=Catarrhini; Hominidae; Pan.
Sequence
MPSPCPVLLRGARAALLLLLPPRLLAWPSLLLRRPLSAASCAPISLPAAASRSSMDGAGA
EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVD
RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC
TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEME
SVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPET
AQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEK
DHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKV
GISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPL
VAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEF
TIETEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDE
QRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYAR
TDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVRDLANGNITWADVE
ARYPLFEGQETGKKETIEE
Download sequence
Identical sequences H2R5E9
ENSPTRP00000048086 ENSPTRP00000048086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]