SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R5K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R5K7
Domain Number 1 Region: 247-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-58
Family Reprolysin-like 0.0005
Further Details:      
 
Domain Number 2 Region: 556-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 842-899
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000111
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 903-959
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 1017-1068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 962-1017
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2R5K7
Sequence length 1117
Comment (tr|H2R5K7|H2R5K7_PANTR) ADAMTS6 isoform 1 {ECO:0000313|EMBL:PNI41063.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0034288 OC=Catarrhini; Hominidae; Pan.
Sequence
MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFT
VKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDG
PQWKHDFLDNCHYTGYLQDQRSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKHF
SYENGHPHVIYKKSALQQRHLYDHSHCGVSDFTRSGKPWWLNDTSTVSYSLPINNTHIHH
RQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIVA
RLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRYD
ICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAP
GQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKG
WCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGE
RKRYRSCNTDPCPLGSRDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYN
FYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAIE
GFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYINGAWTIDWPRKF
DVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV
GFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCP
PEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPCNNQSCP
PQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPP
RWVTGDWGQCSAQCGLGQQMRTVQCLSYTGQASSDCPETVRPPSMQQCESKCDSTPISNT
EECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences H2R5K7
ENSPTRP00000048252 ENSPTRP00000048252 9598.ENSPTRP00000048252 XP_526907.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]