SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R678 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R678
Domain Number 1 Region: 314-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-32
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 449-561
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2R678
Sequence length 1302
Comment (tr|H2R678|H2R678_PANTR) Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 {ECO:0000313|Ensembl:ENSPTRP00000048840} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0014902 OC=Catarrhini; Hominidae; Pan.
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRSPLRQET
NMANFSYRFSIYNLNEALNHGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKATQK
LPVSRHTLKHGTLKGLSSSSNRIAKPSHASYSLDDVTAQLEQASLSMDEAAQQSVLEDTK
PLVTNQHRRTASAGTVSDAEVHSISNSSRSSITSAASSMDSLDIDKVTRPQELDLTHQGQ
PITEHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQA
AKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGY
SLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLL
GKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYV
PKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGIRIAKYGKQLYMNYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPESQS
NHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNRLYTSLVPP
LSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFVKYS
TITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNGVVPPPPPPPPPPTPGSAMAQL
KPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLPPQAPPKPLVTIPPP
TSTKTVAPVVTQAAPPTPTPPVPPAKKQPAFPASYIPPSPPTPPVPVPPPTLPKQQSFCA
KPPPSPLSPVPSVVKQIASQFPPPPTPPAMESQPLKPVPANVAPQSPPAVKAKPKWQPSS
IPVPSPDFPPPPPESSLVFPPPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGG
KKPPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSPSKETLPPPAAPPKPG
KLNLSGVNLPGVLQQGCVSAKAPVLSGRGKDSMVEFPSPPSDSDFPPPPPETELPLPPIE
IPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPTRPKRNDSTRLTQAEISEQPTMATVV
PQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRMSRAEPTATMDDMALPPPPPE
LLSDQQKAGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Download sequence
Identical sequences H2R678
ENSPTRP00000048840 ENSPTRP00000048840 XP_009442329.2.37143 XP_016805839.1.37143 XP_016805840.1.37143 XP_016805841.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]