SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R6D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R6D0
Domain Number 1 Region: 116-258
Classification Level Classification E-value
Superfamily L domain-like 1.26e-31
Family U2A'-like 0.031
Further Details:      
 
Weak hits

Sequence:  H2R6D0
Domain Number - Region: 1822-2055
Classification Level Classification E-value
Superfamily Tropomyosin 0.000602
Family Tropomyosin 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2R6D0
Sequence length 2325
Comment (tr|H2R6D0|H2R6D0_PANTR) Centrosomal protein 110kDa {ECO:0000313|EMBL:JAA38562.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0012440 OC=Catarrhini; Hominidae; Pan.
Sequence
MKKGSQQKIFSKAKIPSSSHSPIPSSMSNMRSRSLSPLIGSETLPFHSGGQWCEQVEIAD
ENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIEN
LEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNE
IEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKLLQDLISLILVENPVVTLPHYLQFT
IFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEI
KNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELTRACQKQYELEQELAFYK
IDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNMFATESYIIDSAQAVQIKKVEPDE
QLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSELHDEIEKAEQQILRATEEFKQLEEA
IQLKKISEAGKDLLYKQLSGRLQLVNKLRQEALDLELQMEKQKQEIAGKQKEIKDLQIAI
DSLDSKDPKHSHMKAQKRGKEQQLDIMNKQYQQLESRLDEILSRIAKETEEIKDLEEQLT
EGQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLRDEKETLLQRLTEVEQER
DQLEIVAMDAENMRKELAELESALQEQHEVNASLQQTQGDLSAYEAELEARLNLRDAEAN
QLKEELEKVTRLTQLEQSALQAELEKERQALKNALGKAQFSEEKEQENSELHAKLKHLQD
DNNLLKQQLKDFQNHLNHVVDGLVRPEEVAARVDELRRKLKLGTGEMNIHSPSDVLGKSL
ADLQKQFSEILARSKWERDEAQVRERKLQEEMALQREKLATGQEEFRQACERALEARMNF
DKRQHEARIQQMENEIHYLQENLKSMEEIQGLTDLQLQEADEEKERILAQLRELEKKKKL
EDAKSQEQVFGLDKELKKLKKAVATSDKLATAELTIAKDQLKSLHGTVMKINQERAEELQ
EAERFSRKAAQAARDLTRAEAEIELLQNLLRQKGEQFRLEMEKTGVGTEANSQVLEIEKL
NETMERQRTEIARLQNVLDLTGSDNKGGFENVLEEIAELRREVSYQNDYISSMADPFKRR
GYWYFMPPPPSSKVSSHSSQATKDSGVGLKYTASTPVRKPRPGQQDGKEGSQPPPASGYW
VYSPIRSGLHKLFPNRDADSGGDSQEESELDDQEEPPFVPPPGYMMYTVLPDGSPVPQGM
ALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGPPPPNFSIPFIPMGVLHCNVPEHHN
LENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEMEELHHNIDDLLQEKKSLECEVEEL
HRTVQKRQQQKDFIDGNVESLMTELEIEKSLKHHEDIVDEIECIEKTLLKRRSELREADR
LLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRS
LQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERN
EDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQA
KADLQEALRLGETEVTEKCNHIREVKSLLEELSFQKGELNVQISERKTQLTLIKQEIEKE
EENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLEL
ENLQQISHQQKGEIEWQKQLLERDKREIEQMTAESRALQSCVECLSKEKEDLQEKCDIWE
KKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLSLHNDISAMQQQLQ
EKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQK
EEETKQQQLQVLQNEIEENKLKLVQQEMMFQRLQRERESEESKLETSKVTLKEQQHQLEK
ELTDQKSKLDQVLSKVLAAEERVRTLQEEERWGESLEKTLSQTKRQLSEREQQLVEKSGE
LLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSC
MQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMANQKDLERRQMEISDAMRTL
KSEVKDEIRTSLKNLNQFLPELPADLEAILERKENLEGELESLKENLPFTMNEGPFEEKL
NFSQVHIMDEHWRGEALREKLRHREDRLKAQLRHCMSKQAEVLIKGKRQTEGTLHSLRRQ
VDALGELVTSTSADSASSPSLSQLESSLTEDSQLGQNQEKNASAR
Download sequence
Identical sequences H2R6D0
ENSPTRP00000049006 ENSPTRP00000049006 XP_016817050.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]