SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R8G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R8G1
Domain Number 1 Region: 4-64
Classification Level Classification E-value
Superfamily HMG-box 0.00000000144
Family HMG-box 0.004
Further Details:      
 
Weak hits

Sequence:  H2R8G1
Domain Number - Region: 167-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00117
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R8G1
Sequence length 434
Comment (tr|H2R8G1|H2R8G1_PANTR) MAEL isoform 4 {ECO:0000313|EMBL:PNI48287.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0027812 OC=Catarrhini; Hominidae; Pan.
Sequence
MPNRKPSRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREEEKEKYAEMARE
WKAAQGKDSGPSEKQKPVFTPLRRPGMLVPKQNVSPPDMSTLSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL
QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN
SSNEEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSPY
MSQKDGYKSFSSLS
Download sequence
Identical sequences H2R8G1
9598.ENSPTRP00000051583 ENSPTRP00000051583 XP_003824639.1.60992 ENSPTRP00000051583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]