SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R8P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R8P4
Domain Number 1 Region: 281-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-41
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-18
Family RING finger domain, C3HC4 0.0084
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000259
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2R8P4
Sequence length 446
Comment (tr|H2R8P4|H2R8P4_PANTR) Uncharacterized protein {ECO:0000313|Ensembl:ENSPTRP00000051815} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=LOC739911 OC=Catarrhini; Hominidae; Pan.
Sequence
MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEARSPANCPACREPSP
KMDFKTNILLKNLVTIARKASLWQFLSSEKQICGTHRETKKMFCDMDKGLLCLLCSNSQE
HGAHKHYPIEEAAEEHREKLLKQMRILWKKIQENQRNLYEEGRTAFLWRGDVVLRAQMIR
NEYRKLHPVLHKEEKQHLERLNKEYQEIFQQLQRSWVKMDQKSKHLKEMYQELMEMCHKP
DVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVYRLNRFRVDISFHFEVTNHNI
RLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWALGVCNDSRIR
KNSTMVNTEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVT
KSSLIWSYPAGSLNFPVRPFFYTGHR
Download sequence
Identical sequences H2R8P4
ENSPTRP00000051815 ENSPTRP00000051815 XP_001141597.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]