SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2R9N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R9N7
Domain Number 1 Region: 62-179
Classification Level Classification E-value
Superfamily L domain-like 1.02e-25
Family Ngr ectodomain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2R9N7
Sequence length 275
Comment (tr|H2R9N7|H2R9N7_PANTR) Leucine rich repeat containing 3C {ECO:0000313|Ensembl:ENSPTRP00000053040} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0039147 OC=Catarrhini; Hominidae; Pan.
Sequence
MRMTSSSFVSYCTPGLCQFMAMLPTAGHLLSLLLVIGTGGTVPSPQVPPRGCYVAKEAGE
RTFRCSQAGLSAVPSGIPNDTRKLYLDANQLASVPAGAFQHLPVLEELDLSHNALAHLSG
AAFQGLEGTLRHLDLSANQLASVPVEAFVGLQIQVNLSANPWHCDCALQEVLRQVRLVPG
TGTGIVCGSGARPDLVGQEFLLLAGEEELCGSGWGGARRSTDVALLVTMGGWLTLVVAYL
VHYVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Download sequence
Identical sequences H2R9N7
XP_003831489.1.60992 ENSPTRP00000053040 ENSPTRP00000053040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]