SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RAQ2
Domain Number 1 Region: 20-138
Classification Level Classification E-value
Superfamily Immunoglobulin 6.4e-21
Family V set domains (antibody variable domain-like) 0.0000659
Further Details:      
 
Domain Number 2 Region: 141-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-18
Family I set domains 0.061
Further Details:      
 
Domain Number 3 Region: 256-336
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000061
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2RAQ2
Sequence length 387
Comment (tr|H2RAQ2|H2RAQ2_PANTR) Sialic acid-binding Ig-like lectin 13 {ECO:0000313|Ensembl:ENSPTRP00000054310} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=SIGLEC13 OC=Catarrhini; Hominidae; Pan.
Sequence
MLPLLLPLLWAGALALEGIFQLEVPESVTVQEGLCVFVPCTFFYPRHTFIKISLARGYWF
REGDNPLRDAPVATNDPARQVREETRGRFRLLGNPREKNCSLSIRDARRRDSGSYFFRVE
ETMMKYNYKDPPLSVHVTALTHRPDILIPGALKSGRPRNLICSVPWACEQGTPPIFSWIG
TSVSPLSPTTALSSVVTLIPQPQDHGSRLTCQVTLPGAGVTTTRTVRLNVSYPPQNLTLT
VFQGDGTASTTLRNESSLQVLEGQSLRLVCAVDSNPPARLSWAQDNLILSPSQPNPGMLE
LPQMHLRNEGEFTCQARNPLGSQQVSLRLFVQRKSGPMAEVVLVAIGEAAVKILLLFLCL
IILRVKSHRRKAAKAATGVEAAKVVKG
Download sequence
Identical sequences H2RAQ2
ENSPTRP00000054310 ENSPTRP00000054310 XP_009434396.1.37143 XP_009434397.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]