SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RBN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2RBN6
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.000732
Family Fibronectin type I module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2RBN6
Sequence length 139
Comment (tr|H2RBN6|H2RBN6_PANTR) Beta-microseminoprotein {ECO:0000256|RuleBase:RU364124} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0014347 OC=Catarrhini; Hominidae; Pan.
Sequence
MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RNDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences H2RBN6
XP_001168039.1.37143 9598.ENSPTRP00000056006 ENSPTRP00000056006 ENSPTRP00000056006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]