SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RDX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RDX7
Domain Number 1 Region: 68-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2RDX7
Sequence length 155
Comment (tr|H2RDX7|H2RDX7_PANTR) Inhibitor of DNA binding 1, dominant negative helix-loop-helix protein {ECO:0000313|EMBL:JAA06612.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0048931 OC=Catarrhini; Hominidae; Pan.
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences G3RJ48 H2RDX7 P41134
ENSGGOP00000015723 NP_002156.2.87134 NP_002156.2.92137 XP_001152873.1.37143 XP_004061997.1.27298 XP_016802578.1.37143 ENSP00000365280 ENSP00000365280 gi|31317299|ref|NP_002156.2| ENSPTRP00000059507 GO.78733 HR3123 ENSGGOP00000015723 ENSPTRP00000059507 9598.ENSPTRP00000059507 9606.ENSP00000365280 ENSP00000365273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]