SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2REY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2REY4
Domain Number 1 Region: 212-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.22e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 170-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  H2REY4
Domain Number - Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000742
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2REY4
Sequence length 493
Comment (tr|H2REY4|H2REY4_PANTR) EGF-containing fibulin-like extracellular matrix protein 1 {ECO:0000313|EMBL:JAA20486.1, ECO:0000313|EMBL:JAA20487.1, ECO:0000313|Ensembl:ENSPTRP00000068385} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0015099 OC=Catarrhini; Hominidae; Pan.
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
Download sequence
Identical sequences A0A0S2Z4F1 H2REY4 Q12805
ENSPTRP00000060075 ENSP00000347596 ENSP00000378058 gi|86788015|ref|NP_001034437.1| gi|86788132|ref|NP_001034438.1| 9598.ENSPTRP00000020509 9606.ENSP00000347596 ENSP00000347596 ENSP00000378057 ENSP00000378058 ENSPTRP00000060075 ENSP00000347596 NP_001034437.1.87134 NP_001034437.1.92137 NP_001034438.1.87134 NP_001034438.1.92137 XP_016804050.1.37143 XP_016804051.1.37143 XP_016804052.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]