SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RHA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2RHA1
Domain Number - Region: 31-67
Classification Level Classification E-value
Superfamily L domain-like 0.00128
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2RHA1
Sequence length 71
Comment (tr|H2RHA1|H2RHA1_PANTR) Leucine rich repeat containing 70 {ECO:0000313|Ensembl:ENSPTRP00000060900} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0034310 OC=Catarrhini; Hominidae; Pan.
Sequence
MCGLQFSLPCLRLFLVVTCYLLLLLHKEILGCSSVCQLCTGRQINCRNLGLSSIPKNFPE
STVFLLASKGP
Download sequence
Identical sequences A0A1D5Q908 A0A2I2YA86 A0A2I3H2W9 A0A2I3NI29 A0A2J8RL80 A0A2K5W940 A0A2K5Y7M4 A0A2K6BFT2 A0A2K6KJZ0 A0A2K6NU12 D6RD14 H2RHA1
ENSPTRP00000060900 ENSP00000427117 ENSP00000427117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]