SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RIE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RIE9
Domain Number 1 Region: 76-213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-34
Family C-type lectin domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2RIE9
Sequence length 214
Comment (tr|H2RIE9|H2RIE9_PANTR) CLEC2L isoform 1 {ECO:0000313|EMBL:PNI99690.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0013954 OC=Catarrhini; Hominidae; Pan.
Sequence
MEPAREPPSRARPPPPLAARPAPAPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWKA
ALEDTTTRLLLGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRD
WNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFT
IAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT
Download sequence
Identical sequences G3RRY7 H2RIE9 P0C7M8
ENSPTRP00000061307 NP_001073980.2.87134 NP_001073980.2.92137 XP_003318880.1.37143 XP_004046358.1.27298 9606.ENSP00000390661 ENSGGOP00000018562 ENSPTRP00000061307 ENSP00000390661 gi|168229214|ref|NP_001073980.2| ENSGGOP00000018562 ENSP00000390661 ENSP00000390661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]