SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RQ49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RQ49
Domain Number 1 Region: 51-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.64e-26
Family G proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2RQ49
Sequence length 219
Comment (tr|H2RQ49|H2RQ49_TAKRU) ADP-ribosylation factor-like 10 {ECO:0000313|Ensembl:ENSTRUP00000002264} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=arl10 OC=Takifugu.
Sequence
MVLLRHISVALTAAVAALGSALFIALNFFYKVRRSRRQQCLSVSPQEEEDRGKRQVLVLG
LDGAGKSSMLQGLNAGESAAKRGRCRPTRGFNFMSLNVPACQLDFLEIGGGEDLRPYWSD
YLKRTHILVYVVDSSDRSRLPLAKAELHRLLRVEPQLPVVVLGNKQDKSDALGMSELQEA
LSLGSLADDRKLFLLAAQLGSDGSARNSHQGLDTFQDLL
Download sequence
Identical sequences H2RQ49
ENSTRUP00000002264 31033.ENSTRUP00000002264 ENSTRUP00000002264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]