SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RS80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RS80
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.31e-40
Family SWIB/MDM2 domain 0.0000699
Further Details:      
 
Domain Number 2 Region: 294-338
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.12e-17
Family Ran binding protein zinc finger-like 0.0004
Further Details:      
 
Weak hits

Sequence:  H2RS80
Domain Number - Region: 438-480
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0921
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2RS80
Sequence length 493
Comment (tr|H2RS80|H2RS80_TAKRU) MDM4, p53 regulator {ECO:0000313|Ensembl:ENSTRUP00000002996} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=mdm4 OC=Takifugu.
Sequence
FTMSSLSAEPPSSSSSCRTLPGDGSQQVQPKAPLLQILRVAGAQEEVFTLKEVMHYLGQY
IMGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGCAGNADAAE
NLSVGRECVESGVEDRVRRGGKHLPVPRGQFEEELWVLQVLGHRCRRPREPDEDSLEGLP
RSACKRPKLDVSLDEWDLSGLPWWFLGNLRSNYSCKSNGSTDIHTNQEEDTAIVSDTTDD
LWFLTEGESEQVSVEMKEAALEEGRGGEGEACSEEDDRAGKMQEEPDEDSQCLSDDTDIE
ISTQDAWQCTECRKYNTPLQRYCVRCWALRKNWYKDVPRLAHSLSVPDIPACSSLTAQDD
EDDSDAGIDVPDCTRTVSDPVILPSHSTADRPLPPALSGKGKAPWSSSFHKDEPLSEGDS
QESLGMEVEEVRPEALLEPCKLCRVRPRNGNIIHGRTAHLLTCFPCARRLHKFHAPCPGC
GKIIQNVIKIFIL
Download sequence
Identical sequences H2RS80
ENSTRUP00000002996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]