SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RT84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RT84
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000117
Family Virus ectodomain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2RT84
Sequence length 125
Comment (tr|H2RT84|H2RT84_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000003351} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MAFQNRIAVDMLLAEKGGVCAVFGDQCCTFIPNNTASDGSLTLAIEGLRTLNSKMKEHSG
AKTAMWNEWMNVFGKYKTLVTSILISVAVFAAILTLCGCCCVPCLRSLINRLITTAIAPM
EKPYG
Download sequence
Identical sequences H2RT84
31033.ENSTRUP00000003351 ENSTRUP00000003351 ENSTRUP00000003351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]