SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RUU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RUU5
Domain Number 1 Region: 259-530
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-38
Family Kelch motif 0.0092
Further Details:      
 
Domain Number 2 Region: 667-811
Classification Level Classification E-value
Superfamily C-type lectin-like 5.15e-24
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 3 Region: 60-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 947-993
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  H2RUU5
Domain Number - Region: 29-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00435
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 865-899
Classification Level Classification E-value
Superfamily Plexin repeat 0.00497
Family Plexin repeat 0.0036
Further Details:      
 
Domain Number - Region: 499-606
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00628
Family Galactose oxidase, central domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2RUU5
Sequence length 1237
Comment (tr|H2RUU5|H2RUU5_TAKRU) Attractin {ECO:0000313|Ensembl:ENSTRUP00000003913} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
RSLLMLTPALLLSATVLLSGLPRSTEAKECDKPCMNGQCNAATGSCVCSPGWVGDQCQHC
EGRFRLTGPSGHLTDGPGNYKYKTKCTWLIEGQPNSILRLRFNHFATECSWDHLYVYDGD
SIYAPLLAAFSGLIIPERYGNETVPEVVSQSGYALLHFFSDAAYNLTGFNISYSVSVSLC
LFSVSSVSLTVSSLSLQCLLTSRSFMLLLEKPACAAGAAYECVAKSTGARVAELMCVGGD
CCRLTGPSKITWVRHLLLQLRWDLNHNRNLQRHEGMFCCLFQGKIYMYGGKIDSTGNVSS
QLWVFHIQNQTWVLLSPQITQDQYAVVGHSAHIVPPVQEGSSPTMLVLFGHCPLYGYISQ
VQEYNIARNTWRVLDTIGALIQGGYGHSSVFDPGTRAVYIHGGYKAFSANKYGLAGDLYK
YEVDKRKWTILRDSGFFRYLHTAVIVSGSMLVFGGNTHNDTSMSHGAKCFSSDFLVYNLA
CDEWTVLPRPDLHQDVNRFGHSAVLSDGVMFVFGGFNSLLLSDVLVYTSPSCSASSSQAT
CAQAWPGVLCVWNSTLEACLPWDSSGVGAEPDRTSTSTSRHADNEKCDQYTDCYSCTANT
NGCQWCSGQCVSLGSNCTAATGATVEYEICPKDNPSFVCNKKTSCKSCAVDQNCQWESRN
QECISLPENVCGESWHLVGNSCLKFITANDSYDNAKLACRSHNAVLASLTTQKKVDFVLK
ELQTISRMYKAAVTPWVGLRKINVSYWCWEDMSPFTNTSLQWLPGEPSDAGFCGYLAELA
SSSLKAQSCINPVNGSLCERPANHSAKPCRTPCALRSTCGECTSTSSECMWCSNMKQCVD
SNAYVASFPFGQCMEWYTMNTCPPENCSGYGTCGKCLHQPGCGWCTEPSNTGKGQCIEGS
YRGPFQTFVPAPSTSPAQPASPPPALNVSMCPSEAKYNWSFIHCPACQCNGHSQCVNESV
CEKCEDLTSGRQCESCISGFYGDPTNGGSCQPCKCNGHASMCNPSNGKCFCTTKGIKGDR
CHLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPEEPNRDLDMF
INASKNFNLNITWATSFTAGTQSGEEIPIISRSNIKEFKESFSNENFDFRNNPNITFFVY
VSNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQL
LREMQQMASRPFATINVALETEEEPPDLIGGNVKTAP
Download sequence
Identical sequences H2RUU5
ENSTRUP00000003913 31033.ENSTRUP00000003913 ENSTRUP00000003913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]