SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RUU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RUU6
Domain Number 1 Region: 249-520
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-38
Family Kelch motif 0.0092
Further Details:      
 
Domain Number 2 Region: 658-802
Classification Level Classification E-value
Superfamily C-type lectin-like 5.15e-24
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 3 Region: 58-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-23
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 938-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  H2RUU6
Domain Number - Region: 487-509,539-596
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00209
Family Galactose oxidase, central domain 0.041
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00435
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 856-890
Classification Level Classification E-value
Superfamily Plexin repeat 0.00492
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2RUU6
Sequence length 1228
Comment (tr|H2RUU6|H2RUU6_TAKRU) Attractin {ECO:0000313|Ensembl:ENSTRUP00000003914} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
LLMLTPALLLSATVLLSGLPRSTEAKECDKPCMNGQCNAATGSCVCSPGWVGDQCQHCEG
RFRLTGPSGHLTDGPGNYKYKTKCTWLIEGQPNSILRLRFNHFATECSWDHLYVYDGDSI
YAPLLAAFSGLIIPERYGNETVPEVVSQSGYALLHFFSDAAYNLTGFNISYRSVSLCLSV
SVSLCLFSVSSVSLTVSSLSLQCLFXLHSQRDFSKLLMDHVAELMCVGGDCCRLTGPSKI
TWVRHLLLQLRWDLNHNRNLQRHEGMFCCLFQGKIYMYGGKIDSTGNVSSQLWVFHIQNQ
TWVLLSPQITQDQYAVVGHSAHIVPPVQEGSSPTMLVLFGHCPLYGYISQVQEYNIARNT
WRVLDTIGALIQGGYGHSSVFDPGTRAVYIHGGYKAFSANKYGLAGDLYKYEVDKRKWTI
LRDSGFFRYLHTAVIVSGSMLVFGGNTHNDTSMSHGAKCFSSDFLVYNLACDEWTVLPRP
DLHQDVNRFGHSAVLSDGVMFVFGGFNSLLLSDVLVYTSPSCSASSSQATCAQAWPGVLC
VWNSTLEACLPWDSSGVGAEPDRTSTSTSRQHADNEKCDQYTDCYSCTANTNGCQWCSGQ
CVSLGSNCTAATGATVEYEICPKDNPSFVCNKKTSCKSCAVDQNCQWESRNQECISLPEN
VCGESWHLVGNSCLKFITANDSYDNAKLACRSHNAVLASLTTQKKVDFVLKELQTISRMY
KAAVTPWVGLRKINVSYWCWEDMSPFTNTSLQWLPGEPSDAGFCGYLAELASSSLKAQSC
INPVNGSLCERPANHSAKPCRTPCALRSTCGECTSTSSECMWCSNMKQCVDSNAYVASFP
FGQCMEWYTMNTCPPENCSGYGTCGKCLHQPGCGWCTEPSNTGKGQCIEGSYRGPFQTFV
PAPSTSPAQPASPPPALNVSMCPSEAKYNWSFIHCPACQCNGHSQCVNESVCEKCEDLTS
GRQCESCISGFYGDPTNGGSCQPCKCNGHASMCNPSNGKCFCTTKGIKGDRCHLCEVENR
YQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPEEPNRDLDMFINASKNFNL
NITWATSFTAGTQSGEEIPIISRSNIKEFKESFSNENFDFRNNPNITFFVYVSNFTWPIK
IQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMAS
RPFATINVALETEEEPPDLIGGNVKTAP
Download sequence
Identical sequences H2RUU6
ENSTRUP00000003914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]