SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RVB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RVB3
Domain Number 1 Region: 16-209
Classification Level Classification E-value
Superfamily L domain-like 8.84e-35
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 508-617
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-23
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2RVB3
Sequence length 664
Comment (tr|H2RVB3|H2RVB3_TAKRU) Leucine-rich repeats and calponin homology (CH) domain containing 4 {ECO:0000313|Ensembl:ENSTRUP00000004081} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
RSVEKALEEAAVSGALNLSNRRLKEFPRSARNYDLSDITHADLSKNRLCELPEELCQFMS
LETLSLYHNGMRSLSPSLSNLQALTYLNLSRNLLSSLPPSVFQLPFLRVLIISNNKLCSL
STSIYALTHLRQLDVSCNELQSLPPELGQLECLRDLNLRRNLISITVNKISELPLVRLDI
SCNGISHVPLCYRHLRHLQSISLDNNPLQMPPAQICSKGKYHIFKYLNMEACKRNQEELE
RHLRPTGFSTCLTEQELFTGQIGLLDSGFNSVESGSKRWSGNESTDDFSERSLRMTEVSR
DQMNLEEEQEEDGFSLKTVNGGTDHLDSTESSMTEVEEDVGMEPPPPLTAPPSFYVEEGP
PSPSSSSSDDSSPLSPSSPTIDQRKKPGTLLIWQERERLQQQREKARKKLMSYHRTANNN
NVPQSKTCRSKVPAHILAGGSCTSNMGTKPSDSDMTSSQKMSPPSSQAQKPNSFLFRASS
HSNVRPTGSAYALRESGRSESCMALRSPKEERPEITQLRKTLESHLKITLPEDLGEALSN
GTVLCQLVNHIRPRSVSIIHVPSPAVPKLSTAKSRVNVESFLGACRKLGLPEKAVCTCSD
VLLSNLSPVLDCVTALLAVECEGVVGEKWSHSSSPSSSLLSLDFLLFYCAAMALLCVLYC
YLLT
Download sequence
Identical sequences H2RVB3
ENSTRUP00000004081 31033.ENSTRUP00000004081 ENSTRUP00000004081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]