SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RW48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RW48
Domain Number 1 Region: 80-161
Classification Level Classification E-value
Superfamily Virus ectodomain 2.67e-19
Family Virus ectodomain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2RW48
Sequence length 272
Comment (tr|H2RW48|H2RW48_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000004368} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
WWLCGHNAYAHLPANWSGVCAPVHLKDHTIIIYANNTENIAQKRFKRDLNEYEFKPHDSV
WGTDVPQEFKHWTDGQKVSISLFPWVGVAKNILRLETVDYRLKVFTNLTKVALAGVKEEM
TALRLMTMQNRMALDLITAPQGGVCAMVGDYCCTFIPENDADGHLIDSALRNLTKLQRAM
IDDGSPPPDWLTKMLSGWRELLFKIGIMIGIVLLVLAILACCVVPLVRGCIGRLVGSVVT
STLLQVEEQSLLDDDEEESEEEWINVIQDEND
Download sequence
Identical sequences H2RW48
ENSTRUP00000004368 ENSTRUP00000004368 31033.ENSTRUP00000004368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]