SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2RZ94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RZ94
Domain Number 1 Region: 397-660
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-56
Family YWTD domain 0.0000000198
Further Details:      
 
Domain Number 2 Region: 22-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000118
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 3 Region: 140-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 4 Region: 190-227
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00038
Further Details:      
 
Domain Number 5 Region: 309-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000144
Family EGF-type module 0.004
Further Details:      
 
Domain Number 6 Region: 102-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 226-267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 8 Region: 344-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000157
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 9 Region: 272-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 10 Region: 64-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2RZ94
Sequence length 814
Comment (tr|H2RZ94|H2RZ94_TAKRU) Low density lipoprotein receptor b {ECO:0000313|Ensembl:ENSTRUP00000005465} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=ldlr OC=Takifugu.
Sequence
ILRKTIIALLLRCAQNAAVDAAFICSSTQFKCGNGRCITSRWICDGTDDCGDGTDELQET
CASKTCLPSEYNCGAPLNQCIPGGWHCDDKADCGNEADERNCTAKECKDNEFQCANGHCV
SASFVCDKDDDCSDGSDEASCPKPTCSGRSFQCNNSVCVPAQWRCDGDSDCADGSDEWPQ
NCDGRQKKPASRCSRHEFQCADGECIHGSWRCDGGTDCKDRSDEVNCSRSRCPGDQFQCF
DGTCIAGTLQCDGKHDCSDLSDELGCHIARACEGPAMFKCNTGECISMEKVCNKQRDCVD
NSDEPDEECDRNECQTNNGGCSHYCSDLKLGFNCSCPAGYSLKMDKKTCEDIDECAEPDT
CSQVCINLVGSYKCDCMGGYQIDPLTKTCKAQSGVVPMLYFTNKHDVRRMTLDRSEYVRL
IPQLKNVVALDIDMPNKTIFWSDLSLKKIYSSKIDTAGNSSHHTVVIDSGIGAPEGLAVD
WIHGNIYWIDSALQTISVATTDGSRRKTLITENLEKPRAIVVDPINNFMFWTDWGQQAKI
EKCGLNGMDRIALVTDNIVWPNGITLDVSNHRLYWVDSKLHTLSSIDVNGGTRHSVLFSE
EHLSHPISLTVFQNQVFWTDMDHSAVMSANRLTGRDIRTLAVELDQPEDIILYHDLKQPT
GREPSLRLLHPDNGRVPSLLRTPAQRRRRSNPTLRRPRRPLPPLLEPPPKLAPPVRLLPR
LKVAESAGHDLESVQTPSAEYESLSLPAVVTALVVFGAVLVWRHWRLRNTNTIHFDNPVY
QKTTEDELHICRNGSDGYIYPERQMLSTDDIDVA
Download sequence
Identical sequences H2RZ94
ENSTRUP00000005465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]