SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S2R5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S2R5
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000538
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2S2R5
Sequence length 136
Comment (tr|H2S2R5|H2S2R5_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000006687} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
LNQKLRELTEEEEEPPRPQTCSDVQPAQDAQCPSSRWYWKLVPIRYRKDKVQSKLTPTFP
LIHGVKDLSNGCAIASVLHYYCPVLLPLEDVCLKDTMSVADSVYNLQLIREFCESSLQSC
CPLAVEDLLYAPPPLH
Download sequence
Identical sequences H2S2R5
31033.ENSTRUP00000006687 ENSTRUP00000006687 ENSTRUP00000006687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]