SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S5J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S5J6
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-36
Family PDI-like 0.0000255
Further Details:      
 
Domain Number 2 Region: 365-470
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.09e-32
Family PDI-like 0.00065
Further Details:      
 
Domain Number 3 Region: 230-363
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.48e-27
Family PDI-like 0.033
Further Details:      
 
Domain Number 4 Region: 142-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.97e-25
Family PDI-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2S5J6
Sequence length 506
Comment (tr|H2S5J6|H2S5J6_TAKRU) Protein disulfide-isomerase {ECO:0000256|RuleBase:RU361130} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MMKFLLLCTLVVASRAEIAEEDDVLVLKKSNFDEALKAHPNILVEFYAPWCGHCNALAPQ
YAKAAATLKEEGSEVRLAKVDATEETDLAQEFGVRGYPTIKFFKGGDKDSPKEYSAGRQA
EDIVSWLKKRTGPAVASLTGVTEAESLIADNEVAVIGFFKDGSSADAKAFEKAAEAIDEI
PFAMTSDDAVFSKFEVSTDSVVLFKKFDEGRNTFDGEVTKENLLNFVKSNQLPLVIEFTE
QTAPKIFGGEIKSHILMFLPKAASDFQDKMDQFKKAAEGFKGQILFIFIDSDIEDNQRIL
EFFGLKKEECPAIRLITLEDEMTKYKPESDAITTEGIIEFCTKFVEGKLKAHLMSQDIPE
DWDKTPVKVLVGKNFEEVVFDPSKNVFVEFYAPWCGHCKQLTPIWEKLGEKYKDSADTIV
AKMDSTANEIEAVKVHSFPTLKFFPAGDEHKVIDYNGERTLEGFTKFLESGGKEGGAPAG
DDEDDPEADDIEDDTDGEDDDGHDEL
Download sequence
Identical sequences H2S5J6
ENSTRUP00000007668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]