SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S762 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S762
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 7.19e-85
Family Integrin A (or I) domain 0.000000253
Further Details:      
 
Domain Number 2 Region: 360-469
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-20
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 641-725
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000418
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 4 Region: 26-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 599-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 555-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Integrin beta EGF-like domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2S762
Sequence length 797
Comment (tr|H2S762|H2S762_TAKRU) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101061453 OC=Takifugu.
Sequence
CLCRAGPSIITLSAVLSISWAQQEGSVCIKANAQSCGECIQVSESCGWCTDVSFLSEGES
KSARCDDLESLKKRKCTAESIENPRGSVVVDKDKPVTNRRNEPGKLKPEQITQIQPQKLT
LTLRSGEPQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMKEMQKITSDF
RIGFGSFVEKTVMPYISTTPARLANPCTGNQNCTSPFSYKNVLKLTNKGDEFNRLVSQQQ
ISGNLDSPEGGFDAIMQVAVCQNEIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGK
CHLEKDMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIKLIIDAYNSLSSEVILENGKLPEGVSINYKSICKNGVEGTGENGRKCSNISI
GDEVFFQISVQADKCPADSRSETIRIKPLGFTEEVEIVVNFICDCECAAKGEPQSSKCDN
GNGIFQCGACKCNEGRIGRVCECSKDDVHTEDLDANCRKDNGTDICSNNGDCVCGTCECK
KRQNPAEIYSGKYCECDNFNCDRSNNMLCGGERHGRCECRKCICDANYTGSACDCSMDKS
TCMAKNGQLCNGRGLCECGICKCTDVKFQGPTCEICPTCPGVCQEHKDCVLCRAFPSEKP
CVNCSYFDLVKVADRDKLPQPTDQSFPLTHCKVRDENDCWVYYTFAIQNQTRLVHVVEKP
GCTEGPDIVPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENP
IYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2S762
ENSTRUP00000008234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]