SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S8F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S8F7
Domain Number 1 Region: 56-514
Classification Level Classification E-value
Superfamily Sema domain 2.35e-142
Family Sema domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 510-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000174
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2S8F7
Sequence length 763
Comment (tr|H2S8F7|H2S8F7_TAKRU) Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D {ECO:0000313|Ensembl:ENSTRUP00000008682} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
ARLWLFLGWCLSSTTASTLFPKDLEPTSVVDSEQSRLFPSFQGLLQDNNTLRLGLDFQRM
IRINHMLYIAARDHVFAVNLTTASEQFVPQLKLTWRSKDVNKCLVRGKNSDECYNYIKVL
VPRDDETLFACGTNAFNPTCRNYKMVSLEQVGEELVGQARCPFESGQSNVGLFAGGDFYS
ATMTDFLASDAVIYRSLGDGRPVLRTVKYDSKWLREPHFLHAIDYGNYVYFFLSEMAVEY
TALGKVVFSRVARVCKNDNGGSPRVLDRYWTSFLKARLNCSVPGDSFFYFDVLQSLTNVL
QINQRPAVVGVFTTQANSIPGSAVCAFYMDDIEKVFNRKFKEQRANDLSWTPVAEELVPQ
PRPGTCAGDGAAAEYKSSVQFPDEMLTFIKTYPLMDEAVPSVNERPCFTRTSSRSKLTQI
VVDVSAGLTKDRTVMFLGSEDGRILKVLASTHPNNSVGTELLEDIDVYNPSKCDVQGQED
RRVLGLELDKDHHALFVAFSSCVIRVPLSRCGHHGTCRRACLTSTDPYCVWLRTGRCGNR
PPGFRAEFEQEVEGDHVLNADSCDTSTTAHNQEAATGPAHGKYNCNTEAPPPLSVHQHMV
AFGSFTTMECAVLRSYLDQRVAAHVHYTLLIACVLVAFSLGAILSGFLVSCYCSRSAAQR
ACRLGKDPEASLSHALSLRSLAKISGLLDTQSKVGVAKGLEHLHPPVNNAIVDLMKTQDL
IFKEAHQADGELSGLPTPDSTPKMSGRKTQQHRQYERNQNWNN
Download sequence
Identical sequences H2S8F7
ENSTRUP00000008682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]