SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2S8U6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S8U6
Domain Number 1 Region: 88-312
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.01e-17
Family YhfI-like 0.06
Further Details:      
 
Domain Number 2 Region: 15-118
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000409
Family Rieske iron-sulfur protein (ISP) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2S8U6
Sequence length 586
Comment (tr|H2S8U6|H2S8U6_TAKRU) Cytidine monophospho-N-acetylneuraminic acid hydroxylase {ECO:0000313|Ensembl:ENSTRUP00000008822} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC777967 OC=Takifugu.
Sequence
QKAQVVLLLDAEVVNSLQVGINFKKSPEDGKSYILYKSKSGLKACKNQCKHQGGLFIKDI
EDLDGRTVKCTKHNWKLNMLTMKYMNPPDSFMQDELEVEYLGDGGLQLVELNPPDPWLAN
PRERLVLKEGEVKVTYLTHACMELQLGERRFMFDPWLKGPAFARGWWLLHEPPADALDRL
CAADLIYISHIHSDHLSYPTLKVLSERRPDAPIYVGDTSRPVFWYLEQSQVKLTNINVVP
FGVWQNVDEHLRFMILMDGIHPEMDTCIIVEYKGHMILNTVDCTRPNGGRLPQSVDLMMS
DFAGGASGFPMTFYGGKYSDSWKADFIKTERKKLLNYKAELVKTLEPRIFCPFAGYFVEA
HPSDRYIKDTNVKNSAEALNALINKIRPDTLTWTPKPGSVLDLGLALSDPTNSGAIAFPP
ASTQIYKVSWEFDLYLDELRSAISSEIFKHQNWIQFYYTWAGFQNYNLVIRVIETDDKFV
HVTDGWDYLVDFLDLSFPKKRPEREHFYLELKNRLSVMRYVVLHGRLWDDLYIGFQNRIS
RDPDIYHHRFWNHFQTELPVTRPDWDQFLQLYEFNVTALLENCTTV
Download sequence
Identical sequences H2S8U6
ENSTRUP00000008822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]