SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SAG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SAG9
Domain Number 1 Region: 387-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-53
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.44e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 143-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.01e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  H2SAG9
Domain Number - Region: 210-282
Classification Level Classification E-value
Superfamily BAG domain 0.0612
Family BAG domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2SAG9
Sequence length 569
Comment (tr|H2SAG9|H2SAG9_TAKRU) FinTRIM family, member 82 {ECO:0000313|Ensembl:ENSTRUP00000009395} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074420 OC=Takifugu.
Sequence
MADHTSPDYFSCTLCLSLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNANAAQDSVYAGASDVPCDFCMGKKLKAVKSCLNCL
ASYCEKHLKPHYESATFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERSEKQKLLGVSQAEIRQKCQERVKELEELKTAVDSLKNSAQRAMVESQ
KMFEDMIRSIDRMRSEVTKLIGINEKAAFNQAEALIERLEQEIDELKKKESGLKQLYGTD
DHIHFLQNFNYLCTPTDDGFIPRVSLNPDFSFAAVRKAVAEIKERLEEFGREELLKISNK
KTNRTLCAGVAKEVTTDGVSSEPKSRADFLKYFCQLKLDPNTAYKELYISENSRKVIRTR
DLQPYGDTSDRFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYRSISRKGKGSMCLLG
YNDKSWSLLCSDTGYSAWHNRVDKSISAPHSPRIGVYLDHSAGVLAFYSISGSMTLLHRF
ETTFVEPLYPGFGVGTSVKICNLKKKKEK
Download sequence
Identical sequences H2SAG9
ENSTRUP00000009395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]