SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SAH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SAH5
Domain Number 1 Region: 405-563
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-50
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 143-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.85e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  H2SAH5
Domain Number - Region: 210-282
Classification Level Classification E-value
Superfamily BAG domain 0.0604
Family BAG domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SAH5
Sequence length 564
Comment (tr|H2SAH5|H2SAH5_TAKRU) FinTRIM family, member 82 {ECO:0000313|Ensembl:ENSTRUP00000009401} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074420 OC=Takifugu.
Sequence
MADHTSPDYFSCTLCLSLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNANAAQDSVYAGASDVPCDFCMGKKLKAVKSCLNCL
ASYCEKHLKPHYESATFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERSEKQKLLGVSQAEIRQKCQERVKELEELKTAVDSLKNSAQRAMVESQ
KMFEDMIRSIDRMRSEVTKLIGINEKAAFNQAEALIERLEQEIDELKKKESGLKQLYGTD
DHIHFLQNFNYLCTPTDDGFIPRVSLNPDFSFAAVRKAVAEIKERLEECDSSDGGTQTRE
ASVLINENVACVAVSEMPVYTTESRTLDRRSRGERQVNDPLADFCQLKLDPNTAYKELYI
SENSRKVIRTRDLQPYGDTSDRFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYRSIS
RKGKGSMCLLGYNDKSWSLLCSDTGYSAWHNRVDKSISAPHSPRIGVYLDHSAGVLAFYS
ISGSMTLLHRFETTFVEPLYPGFG
Download sequence
Identical sequences H2SAH5
ENSTRUP00000009401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]