SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SAT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SAT8
Domain Number 1 Region: 247-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.95e-54
Family Calsequestrin 0.00000177
Further Details:      
 
Domain Number 2 Region: 23-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.47e-22
Family Calsequestrin 0.0000161
Further Details:      
 
Domain Number 3 Region: 146-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-21
Family Calsequestrin 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2SAT8
Sequence length 406
Comment (tr|H2SAT8|H2SAT8_TAKRU) Calsequestrin {ECO:0000256|RuleBase:RU000648} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=CASQ2 OC=Takifugu.
Sequence
FGRFSLFFLCLHLTFLCNAEEGLEFPNFDGKDRVLDINERNYKKALKRYHLLCLFYHEPI
PTNKGLQKRFQMTELVLELTAQVLENKDIGFGMVDSLKDAKVAKKLGLEEVGSLYIFKDD
RVIEFDGEFSSDTLVEFLLDVLEDPVEMINNAMELRAFERMEEDIRLIGYFKGEDSYFKA
FQQASELFQPYIKFFATFDKSTAKHLSLKMNEVNFYEPFMEEPAILPGRPLSEMDIVEFV
KQHRRATLRKLRAENMFETWEDDMDGIHIVAFAEEEDPDGYEFLEILKDVARDNTNNPEL
SIVWIDPDDFPLLTTYWEKTFKLDLFRPQIGVVNVTDADSVWLDMSNDEDLPTAEELEDW
IEDVLSGRVNTEDDDETASDQENSYIYVTEDSYENDEQDEEYDSED
Download sequence
Identical sequences H2SAT8
ENSTRUP00000009516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]