SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SAU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SAU0
Domain Number 1 Region: 244-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-54
Family Calsequestrin 0.00000177
Further Details:      
 
Domain Number 2 Region: 20-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.79e-22
Family Calsequestrin 0.0000161
Further Details:      
 
Domain Number 3 Region: 143-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-21
Family Calsequestrin 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2SAU0
Sequence length 402
Comment (tr|H2SAU0|H2SAU0_TAKRU) Calsequestrin {ECO:0000256|RuleBase:RU000648} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=CASQ2 OC=Takifugu.
Sequence
GWFVSLCLHLTFLCNAEEGLEFPNFDGKDRVLDINERNYKKALKRYHLLCLFYHEPIPTN
KGLQKRFQMTELVLELTAQVLENKDIGFGMVDSLKDAKVAKKLGLEEVGSLYIFKDDRVI
EFDGEFSSDTLVEFLLDVLEDPVEMINNAMELRAFERMEEDIRLIGYFKGEDSYFKAFQQ
ASELFQPYIKFFATFDKSTAKHLSLKMNEVNFYEPFMEEPAILPGRPLSEMDIVEFVKQH
RRATLRKLRAENMFETWEDDMDGIHIVAFAEEEDPDGYEFLEILKDVARDNTNNPELSIV
WIDPDDFPLLTTYWEKTFKLDLFRPQIGVVNVTDADSVWLDMSNDEDLPTAEELEDWIED
VLSGRVNTEDDDETASDQENSYIYVTEDSYENDEQDEEYDSE
Download sequence
Identical sequences H2SAU0
ENSTRUP00000009518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]