SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SED9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SED9
Domain Number 1 Region: 365-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-53
Family SPRY domain 0.00044
Further Details:      
 
Domain Number 2 Region: 130-194
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.87e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000109
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Weak hits

Sequence:  H2SED9
Domain Number - Region: 169-297
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000806
Family FCH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2SED9
Sequence length 549
Comment (tr|H2SED9|H2SED9_TAKRU) FinTRIM family, member 83 {ECO:0000313|Ensembl:ENSTRUP00000010770} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074873 OC=Takifugu.
Sequence
SCYLCKEHLRDPVSIPCGHVFCSICLKTYWDHADHTGSFLCPQCRVTYNKRPTPRRVGGS
RYSTLPRDSFPPPPPSPDYNYAGPQDVGCDICIGKKHKAVKTCLMCLASYCEKHLKPHFE
SATFKRHKLVDEIGHLDRQICPQHQKGLELYCRTDQMCICVLCTVKEHKGHDMVSAEQER
AEEQQRLGATQADVQEKIHDRLKQMEELKQAVDALKNSAQRALQECEKTFSDMIRAIERM
QQEMAKLISSNKRAALNNAEGHLERLTHEISDLKRRDNEITQLSRTEDHIHFIQSYHMLI
AQTEAEELPTVSVNPYFSFGPVTKAVSEMKQHLNEFSNEELVKVAKAGEEAPMYKSVPVQ
EPQYREDFLRYACQLTLDPNTAYRQLYLSRGNRKATLKRDPQAYHDSAARFDSLPQVLCV
EPLSGGAYYWEVDWSGEGAAIGVTYKGIKRAGYGDGCRIGYNRKSWSLFCSDSSYSARHS
KDQLEITAPYSSRIGVFLDHAGGTLSFYAVGESMSLIHRFKASFGEPVYPGFWVWKGQNT
CIRPAELSI
Download sequence
Identical sequences H2SED9
ENSTRUP00000010770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]