SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SEJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SEJ0
Domain Number 1 Region: 147-389
Classification Level Classification E-value
Superfamily vWA-like 4.67e-84
Family Integrin A (or I) domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 363-478
Classification Level Classification E-value
Superfamily Integrin domains 3.71e-22
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 647-736
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-19
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 35-93
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000481
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 604-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 563-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  H2SEJ0
Domain Number - Region: 485-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0173
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2SEJ0
Sequence length 808
Comment (tr|H2SEJ0|H2SEJ0_TAKRU) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101067303 OC=Takifugu.
Sequence
SSYSSLIITQMDLRLLLISTLLGTFYNSYAQKEGNECIIASAKHCGECIQAGAKCGWCKD
PAFLKQGEAVSTRCDELQSLVKRGCNVDMIESPKGEKKILRNKPVTNRKKGGEKLQPHEI
TQIQPQKLNLTLRSGEPQTFDLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMQ
KMSKITSDFQIGFGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYRNVLNLTSDGKQ
FNTLVGQQQISGNLDSPEGGFDAIMQVAVCGNLIGWRDVTRLLVFSTDAGFHFAGDGKLG
GIVLPNDGKCHLEDNVYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNL
IPKSAVGTLSANSSNVINLIIDAYNSLSSEVILENSKLPSGVTITYTSRCKNGVVNGGEN
GRKCSNISIGDEVTFSISVTSKGCPNEGMSDTIKIKPLGFTEELEITLNFICGCDCQKVG
INKSPLCHSNGTYECGDCRCEDGHVGRECECSSNDVATEDMDRTCRKDNTTDICSNSGDC
VCGTCECKNRDNPEERYSGQFCECDNFSCDRSGNKLCGGHGRCECRVCVCDLMWAGSACD
CSLDNTTCMASNKQICNGRGTCDCGICKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRT
FGTGEKKDTCEKDCSYFTLIKVKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNN
TVKEVHVVDSLDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEK
MNAKWDTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2SEJ0
ENSTRUP00000010821 31033.ENSTRUP00000010821 ENSTRUP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]