SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SEK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SEK0
Domain Number 1 Region: 87-265
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.04e-41
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000111
Family WWE domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SEK0
Sequence length 265
Comment (tr|H2SEK0|H2SEK0_TAKRU) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
AESMAAWQYQQGNGFQNFDSTANYELEEALLNNVSSVDITIQGQLYTVQMPSGPATDKQG
NSLQIRRADKDEDTPNHWDVMPANTSCHTVTLAAGSEEYKQVERKFQATCGQTIISIERI
QNPLLWKTLQIKKRNMEQKNGHQNNERILFHGTSEETIATINANGFNRSYAGKNAAHYGN
GTYFAVNAKYSAQDLYSKPNQNGDKHMYLCRVLTGDHTLGQKGMVAPPQKTSNSVELFDS
AVDNQANPHIFVIFSDNQAYPEYLI
Download sequence
Identical sequences H2SEK0
ENSTRUP00000010831 31033.ENSTRUP00000010831 ENSTRUP00000010831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]