SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SFE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SFE0
Domain Number 1 Region: 361-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-60
Family SPRY domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-20
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 133-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000125
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SFE0
Sequence length 521
Comment (tr|H2SFE0|H2SFE0_TAKRU) Si:dkey-46i9.6 {ECO:0000313|Ensembl:ENSTRUP00000011121} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MATTGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQSCIIGYWKTSPLYQCPMCKKSFYKR
PDISVNTVLREIAEQFKEIRVRSVERAEGEEVLCDICLGEGRPLAVKSCLVCLTSYCDEH
LKSHSTRFTKHKLIEPVANMADRMCPKHERLLELFCKKDQTCVCVLCTETDHRAHYTIPV
EREWTEKKAQLKRTEIDVQQMIQDREKKMEEIKHSVELNKASAQREIEESMQVFSELVRS
IQRTQAELVVSIEEKQRQTERWAAGFITELEEEIAGLTRRKKDLENMARTDHIHFLKNFP
ALSGSPSVKDWSETSVSPDICIGMIRKSVTKLKTTLQEMIDKLAESGEIYFIIRIYLYLQ
INQYFVDVTLDPDSANPWLQLSQDRRQVRHLGAWQDLPDHPDRFDTVVIVLAREGFTSGR
HYWEVQVGDKDDWYLGVARSSINRKGRISVSTTQGYWALAMKKGQGYRVSTSPPTLLALE
PKPKRVGIYLDYEEGQVSFYDVRARTHIYTLKDTFTEKVLP
Download sequence
Identical sequences H2SFE0
ENSTRUP00000011121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]