SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SJK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SJK1
Domain Number 1 Region: 71-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.41e-51
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 420-459
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000301
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SJK1
Sequence length 466
Comment (tr|H2SJK1|H2SJK1_TAKRU) Ankyrin repeat and SOCS box containing 10 {ECO:0000313|Ensembl:ENSTRUP00000012584} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=asb10 OC=Takifugu.
Sequence
MSQGSFVFTPMALRSLQQDEDMLRRYECRRRLASRHLPSSYMLRKEARDRTPLGSSRALP
AAVCQDVVVQNALYTGNLEALQELFPRGSRVSLIIEPQGGDMRWVATGEGLWSLSYEQEL
TTPLHITASRGFTECLRLLLQRGADVELAPGGVAALHESCENCQPECTKLLLSHGANANA
VSEDGYMPLHYCAHPESLECAKYLLQYGAAVSGLSADEGDTPLHAAARNGLPGHTELYLR
YGASVNKLNAEGLTPLNAACSQHQELGDLQRYFKVCQTLLMAGADVHVTDQDKHSPLHMS
CKNANPDIVDLLLANGACVNNMDYGGEAPMHNILKVVCYKVSHQPERIVRALLNHGSIRV
WPGALPKVLKHCSMSPRTIEVLLNAYSRLKVTDTWTESVPPEVLQEHKEFYDSVFSLALT
PRSLQHLARCKLRDLLQGRVHKVVPKLGLPTFIKNYLLLEYRGYIH
Download sequence
Identical sequences H2SJK1
ENSTRUP00000012584 31033.ENSTRUP00000012584 ENSTRUP00000012584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]