SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ST31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ST31
Domain Number 1 Region: 52-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.61e-62
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 285-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.99e-21
Family Ankyrin repeat 0.00055
Further Details:      
 
Domain Number 3 Region: 543-583
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000196
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2ST31
Sequence length 586
Comment (tr|H2ST31|H2ST31_TAKRU) Ankyrin repeat and SOCS box containing 2b {ECO:0000313|Ensembl:ENSTRUP00000015568} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MTKFSYSEYLSQFRSAGGKFSNAQSRLRGDRSGEERDVTEPDFCLLLSRDDDDPLVCAIR
RGDLKAFNDVATSAAHRLLKENKDGWMPLHDAAFCGQTECLKTILKAHPGLVDKRTLQEQ
TALLLAVSCEHLSCARCLLEGGADPDISSKNKETPLYKACELENMDMVRLILSYGATVNQ
RCAQGWTALHEAVSRDNTEICETLIRAGASINPPNTYSIAPLTVAAQRGQMRALCHLIEK
GADVNAQACDGVTALYEASKNGHREAVSVLLSKNADANKSTTAGLLPLHAAAQHGDHQIV
SLLVPVTSRARLRHSCVSPLHLAAERNRHAAAAVLLKTGADVNATLACSRSLLYADRRAT
ALYIAVASGGTETAEVLLNAGASLTLDPVSPLLMAVRQGSVRSVSLLLERGADANTRISS
FTTFPTAVALCMNNRPLLKCLLDNGCDALSCFSCTRGRAPHTGPEESQPRNLNGGHIFHS
VNCGEPPGRPMQFCEWISTADMRRWAGPVLELLLQHVAQVQLCGRLLELLDSREEWHAVK
RTTLSPRTLQHLCRLQIRTQMGRYRLKWVRSLPLPDRLIRYLSLAE
Download sequence
Identical sequences H2ST31
ENSTRUP00000015568 31033.ENSTRUP00000015568 ENSTRUP00000015568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]