SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SUQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SUQ0
Domain Number 1 Region: 34-156,195-564
Classification Level Classification E-value
Superfamily Sema domain 2.09e-161
Family Sema domain 0.000000000114
Further Details:      
 
Domain Number 2 Region: 560-611
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000331
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 627-707
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000143
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2SUQ0
Sequence length 714
Comment (tr|H2SUQ0|H2SUQ0_TAKRU) Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3bl {ECO:0000313|Ensembl:ENSTRUP00000016137} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=sema3g OC=Takifugu.
Sequence
MLLFVYVFGSLPMSLSLLSTVLSLLSAPPLIRVSSLSLTDLLSTNRSSIFSGHHGQLALT
SVYLDEYRDRLFLGGKDVLYSLLLGPTSSESKEIYWPPLPGSREHCIETGKEPQTECANF
VRLLQPHNRTHLLACGTGAFQPMCAFISVGHRGERLGLQWDQSQQQYTIVYGRNGRIDDG
HLIPFVVTDPIEQHVFTMDPTNVENGRGKVPHDPSLPFASTFSGGELYTGLTADFLGRDS
VIFRSMGSRSTMRTETDQKLLHDPKFVAAHLVPDNVDRDNDKVYFFFTEKATEAGDREGA
IHTRVGRVCANDVGGQRVLVNKWSTFIKARLVCSVPGPHGIDTHFNQLEDVFLLRTKDER
NPDVYALFSTISNVFQGFAVCVYRMADIREAFNGPFAHKEGPDYRWGAYEGRVPYPRPGV
CPSKITNQPGREFGSTKDFPDSVLQFARNHPLMWRPVYPALRRPVLVKANTPYKLRQIVV
DRVEAEDGQYDVMFIGTDVGTVLKVIALHGGNSLDAEEVTLEELQVFKVPTPITSMDISV
KRQSLYVGSPAGVALVKLHRCETYGNACAECCLARDPYCAWDGAVCARYLANSKRRFRRQ
DIRHGNPVLQCSDQNLSEDLDMTEDRMVYVTENNSTFLECIPRSPQATVTWFVQRDDRKE
EVKLDDRILSTDQGLLFRRVLHQDEGSYICRSREHGFTQTLARLNLQVLQGETV
Download sequence
Identical sequences H2SUQ0
ENSTRUP00000016137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]