SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SXI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SXI5
Domain Number 1 Region: 105-189
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000367
Family Caspase recruitment domain, CARD 0.025
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000225
Family Pyrin domain, PYD 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SXI5
Sequence length 192
Comment (tr|H2SXI5|H2SXI5_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000017123} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101076232 OC=Takifugu.
Sequence
QKTIKMAIKDSLENLGKQNLNKFRSALLDRREGPRVPVSRVEDEDFLGITDVLVSTFGEF
SAAEVTLDLLKQIKCNGEAEALGKTFQSGRPSASVKVDAIKKSSPPDEHFVDKYRCALIN
RVSNIAPILDELLNKKVIDQETYERIRGLPTCQEKIRELYCSGLKGGKACKDAFLKSLEK
NERFLIDHLRTN
Download sequence
Identical sequences H2SXI5
ENSTRUP00000017123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]