SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2SZD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SZD8
Domain Number 1 Region: 343-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.93e-63
Family SPRY domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 24-92
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-17
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 147-212
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2SZD8
Sequence length 531
Comment (tr|H2SZD8|H2SZD8_TAKRU) Bloodthirsty-related gene family, member 33 {ECO:0000313|Ensembl:ENSTRUP00000017776} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
ISTNTRQDTFLFFTIASSLPYKVQFQCFICQNVFCEPVSIPCGHSFCFSCITSHWENAGV
SCPKCQTVFDGRPELCENSFAKEMSEKIRLRRQNASLSLTKSFVYCDVCTGKRSKAVKSC
LVCLASYCESHLEPHLRVATLKIHKLTKPVAMLEKRMCKRHQRLLELFCRSDQKCVCLLC
TESEHRGHHTVPVERESQEKKIQMKRIQDDVQQMIQERMQKVREIKHCVELSKRIETELV
QMIQRKQAAAEQRAERLIAELELEITELERKRCEMEQLSDTEDHLHLLQDQRFPALCSTS
VTTSCSDLVVHADTSLGAVRRAVADLEHQLQASLQRFSFQEHEQVQLYAADVHLDPRTAN
PWLVLSEDGKQVWDGNLKQILVDIPERFNMAPCVLGTKGFTTGRHYWEVDVGEKTSWDLG
VASQSVDRKGVVTLSPEDGYWTVCLRNGSEYRACAGEAELLRLPRKPKIIGVFLDFEDGT
VSFYDADAKSHMYSFTDYQFREAMFPFFNPDISESGTNKSPLTIRAVSGDE
Download sequence
Identical sequences H2SZD8
ENSTRUP00000017776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]