SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T0A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T0A2
Domain Number 1 Region: 268-365
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 420-710
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000000209
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 190-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000685
Family I set domains 0.048
Further Details:      
 
Domain Number 4 Region: 16-69
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 5 Region: 109-186
Classification Level Classification E-value
Superfamily EF-hand 0.000000000117
Family Calmodulin-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2T0A2
Sequence length 767
Comment (tr|H2T0A2|H2T0A2_TAKRU) Follistatin like 4 {ECO:0000313|Ensembl:ENSTRUP00000018090} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=FSTL4 OC=Takifugu.
Sequence
CRRTYCGRGRQCAVMADTGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLERRR
IYVVHSKDCFFKGNTCTMSEYNRLKSTLLNLQPKLQNLGQQDRQRDMEEKRTLVDTMFKY
LDVDQDGLLVGDELEKVSMKEHMEDSLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVVQ
LSLAEDQRISVSTVTVGLSAVLTCAIQGTLRPPIIWKRNGIILNFLDLEDINDFGDDGSL
YITKVTTIHMGNYSCHAYGYEHLCQTHVLQVNVPPVILVYPETQAQEPGVSASLHCHADG
IPNPKLLWLKNGLELQPRSSKQLSLLANGTELLIGSVRYEDTGAYTCIAKNEVGVDEDIS
SLFVEDSAKKTRLSVGNMFYVFSDEGITVLQPSECEIRRHMKRTERIVATYDEMCPKGEG
VSPQRCVWSSAVNVRDKYIYVTQPLLSRLLVVDIQAQKVVQAVATDPFPVKMLYDKSHDQ
VWVMTWGDMDRTHPTLQVIPQASVGEVHRAIRTTFQRVTDFFIPPTNLIITHVRFAFVFL
KNEPAVHKIDLETFHRVKTISLKNYSCIPVSMAYTHLSGFYFVQCQSKSRLRAPPQLLID
SVTDAVIGPNLNVTGRPFVSPDGRYVVTPDPGSAKLIVQTVSFQGELSLNLELDEPLAVS
DVAFQPSFVESNQHVVVATSGSSTDLLFADLSSGRVEVLRSLKEPLAPQAWPWGVPNRVV
VSSGLFGQYLVTPSAESLFVLNGKQRTPHCEVSDIKRGNTVVWVGEV
Download sequence
Identical sequences H2T0A2
ENSTRUP00000018090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]