SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T0U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T0U8
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2T0U8
Sequence length 316
Comment (tr|H2T0U8|H2T0U8_TAKRU) Retinoic acid receptor beta {ECO:0000313|Ensembl:ENSTRUP00000018286} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=RARB OC=Takifugu.
Sequence
IRKLIPILCSPSAVRNDRNKKKKESPKPELAESYELTAELETIIEKIRKAHQETFPSLCQ
LGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRVPGFTALTIADQITLLKAA
CLDILILRICTRYTPDQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPIEMDDT
ETGLLSAICLISGDRQDLEEPSKVDQLQEPLLEALKIYVRKRRPSKPHMFPKTLMKITDL
RSISAKGAERVISLKMEIPGSMPPLIQEMLENSEGQDGQSSSSSSSSSASADGGASPSSK
SSPDEEDATVATPESP
Download sequence
Identical sequences H2T0U8
ENSTRUP00000018286 31033.ENSTRUP00000018286 ENSTRUP00000018286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]