SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T1K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T1K1
Domain Number 1 Region: 372-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-46
Family SPRY domain 0.00071
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-20
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000763
Family B-box zinc-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2T1K1
Sequence length 561
Comment (tr|H2T1K1|H2T1K1_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000018539} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101061676 OC=Takifugu.
Sequence
KGAQLDWDIASCSICLDALKNPVTVPCGHNYCMDCINTYWKAAERGQQSYVCPQCRKSFT
PRPVLTKNTMLAAIVEELKKTGLHEAPADHGHAGSGDVACDVCTTVKAVKSCLVCLVSFC
ENHLQPHHQMPPLMTHKLVEPCQNLQEKACGSHAEVKTMFCRTDQQCICRLCLAESHKGH
DTVSAAAERREKQRNLAVRQLKIQQMIRERKEDVTVLQQRVEVINHSANKAVKDSHQIIT
QLIDFLVEKRVRSHQEAEVSQVKEAEKKLECDIVELRSREDELRRILHIEDDNQFLQRSA
LLLPLSPAGDPPRFSESSTGYFEDVTAFLSKITNTSQKIFRKNMAKISQRRAEKNSLQSK
PQSEPQSEPQSRRDFLEYLCKLTLDADTAHTQLHLSAGNRTATVTNQNLNYPSHPGRFTQ
CCQVLSKGSMTGRCYWEVKWDGPAVYIAVAYADVKRDGQWTQSGFGSTDKSWALYCDNAK
YIFCHNSCTTPVSGPPSSALGVYLDHSTGLLSFYSVTSEALTLLHKVHTTFTQPLHAGFS
FYNYPGTKASTCCLFTKEKRK
Download sequence
Identical sequences H2T1K1
ENSTRUP00000018539 31033.ENSTRUP00000018539 ENSTRUP00000018539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]