SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T3D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T3D3
Domain Number 1 Region: 485-797
Classification Level Classification E-value
Superfamily L domain-like 5.95e-43
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 24-426
Classification Level Classification E-value
Superfamily L domain-like 1.67e-38
Family Ngr ectodomain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 891-1040
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.83e-28
Family Toll/Interleukin receptor TIR domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2T3D3
Sequence length 1055
Comment (tr|H2T3D3|H2T3D3_TAKRU) Toll-like receptor 9 {ECO:0000313|Ensembl:ENSTRUP00000019171} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074848 OC=Takifugu.
Sequence
NPFMYWTRKTTMRFLILCQLLPIVSSINPIFLPCDTDANTSRVDCSDRPLRRVPLIKSDT
VTSLRLSRTKIRHLWQYDLSGVPNLRAFTMADNCQPSSMKASLHDCEVKIDHGVFRNLSL
LQVLNLSGNSLTSLPKLPANLRVLNLQRNHLFNIVEPLKTPHLQELYLTKNCFYANPCQQ
SLEISKTVFRELSRLKTLTLAYNNLTSVPEGLPSSLEILDLSENTITEVLEGAFADLTHL
RELNLEWNCQRCDRAARPCFPCPRHLPLQLHSKSFYANKSTLTYLNLRGNSLRTFPKGLF
QPLKNLKMLDLSDNFLSYAIQNGTFFAELTSLAWISLIYNYEPLKMFPELFLSPHIGDIS
GLQYLLLSGNFFHSLSGQSFEVLSKLRNLKKLELRMNFIDNINMKALHQVPSLVHIDLSQ
NRLSFIPQCSVSPAERESHHNQNVRDLSFSQPFLMETKPNVTFGFNFLDQSHRLETSQSF
PTQSSPLWETFCKNKVTFDLSQNDIMSVNQEVLAGMENAVCLDLSFNYMSQALKYGMFSS
MKHLVFLNLSYNRLDFYYNESFSELNNTLKLLDLSNNDFHFKMRGMGHRLTFIKNLVNLE
VLSLANNAIAMRIDQRLVSASLKQLSFNGNDLNTMWSSENNQYVNFFHNLTSLTYLDISD
NKLRLVSPEVLCNLPRSLQNLSLSNNRLNYFPWENISVLSNLRHLDLSQNFISFLPYTVV
HAAEPLSLLDLSHNRIGYVPRSFFLAMNSLQRLYLSHNQLKQLNQHFLPAPFKNGSGPRT
LSLHVNPFKCDCDASWFADFLRNTPIEIPHLTTNVHCEYPESQRGKTILSMDQRSCQDIY
GNLASVVCSFLVIGFTVLPLLKHLYGWDLWYSLQVLWAGFKGYSQLTGQDTKYNYDAFVV
FDTSDLAVRDWVYNELLVNLENSAHRMFCLCLEERDWVPGFSCIENLHNAVSSSVKTMFV
LSTGTIESMSGMIRQAFFMVQQRLLDEKVDTAVLVLLDEMFPKLKYLQLRKRLCRKSVLS
WPRNPKAQPLFWNQLRMALSSDNLSFYDNNMSESF
Download sequence
Identical sequences H2T3D3
ENSTRUP00000019171 31033.ENSTRUP00000019171 ENSTRUP00000019171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]