SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2T7Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2T7Z4
Domain Number 1 Region: 164-263
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-31
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 297-407
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2T7Z4
Sequence length 664
Comment (tr|H2T7Z4|H2T7Z4_TAKRU) Ras association (RalGDS/AF-6) and pleckstrin homology domains 1b {ECO:0000313|Ensembl:ENSTRUP00000020784} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
SDKEDQDLDKMFGAWLGELDKLTQVDTHMRGERQETNMANFSYRFSMYNINEALNQGDTV
DLDALMADLCSIEQELNTISKPNSTSRSHNKSCVQKSVYVGEKSQIGETSTNVKISSVQS
YKDREPDQLNDKRLGEQLSPPHPLLDEEQAAKLKAERIRVALEKIKEAQVKKLVIRVHMS
DESSKTMMVDERQTVRQVLDSLLDKSHCGYSPDWSLVETITELQMERIFEDHENLVENLL
NWTRDSHNKLMFTERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPE
IEGILWLKEDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQDYRS
KYKAPTDYCLALKHPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKKYGKQLYGNYHEAM
KRTEAAYDWSSLSTSSIRSGSSSVSIPDSGVDTTSSQGRSQSVVSSIFSEAWKRGTQIEE
NTKPPPQLQHHHPPQPVQPPTPPHPSQFPPPPAPAKMFTSGFGPHTTPKPVSPVSPFPPA
PPPATLGGLTPPPPPPPPLQSPEFPPPPTDSNAAFVAAAPPPPPPPPPPLHTAPVTGLAP
PPPPPPPPAPVTGPTPPPPPLPNNTPEPPPLSSPPATSPKGSSGQPNFLEDLNRTLKRKS
VGRQ
Download sequence
Identical sequences H2T7Z4
ENSTRUP00000020784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]